SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L8J3Q3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L8J3Q3
Domain Number 1 Region: 433-562
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000133
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 624-666
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000281
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 3 Region: 726-852
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000011
Family Growth factor receptor domain 0.0082
Further Details:      
 
Domain Number 4 Region: 369-411
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000218
Family EGF-type module 0.009
Further Details:      
 
Domain Number 5 Region: 658-699
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000511
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 6 Region: 333-373
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000242
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 292-336
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000959
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 703-737
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000016
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  L8J3Q3
Domain Number - Region: 588-624
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000392
Family EGF-type module 0.066
Further Details:      
 
Domain Number - Region: 850-909
Classification Level Classification E-value
Superfamily FnI-like domain 0.00534
Family VWC domain 0.033
Further Details:      
 
Domain Number - Region: 409-440
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0304
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) L8J3Q3
Sequence length 1213
Comment (tr|L8J3Q3|L8J3Q3_9CETA) Delta-like protein {ECO:0000256|RuleBase:RU280815} OX=72004 OS=Bos mutus (wild yak). GN=M91_15231 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
TRGRPGRPLSLLLALLCALRAKVCGASGQFELEILSMENVNGELQNGNCCGGSRNPGDRK
CSRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFDLKASRGNERNRIVLPFS
FAWPRSYTLLVEAWDSSNDTVQPDSIIEKASYSGMINPGRQWQTLKQNTGVAHFEYQIRV
TCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNKAICRQGCSPKHGSC
KLPGDCRCQYGWQGLYCDKCIPHPGCVHGTCNEPWQCLCETNWGGQLCDKDLNYCGTHQP
CLNGGTCSNTGPDKYQCSCPEGYSGPNCEIAEHACLSDPCHNRGSCKETSLGFECECSPG
WTGPTCSTNIDDCSPNNCAHGGTCQDLVNGFQCVCPPQWTGKTCQLDANECEAKPCVNAR
SCKNLIASYYCNCLPGWMGQNCDININDCVGQCQNDASCRDLVNGYRCICPPGYAGDHCE
TDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQCYNRAS
DYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCGPHGKC
KSQSGGKFTCDCNKGFTGTYCHENINDCESNPCRNGGTCIDGVNSYACICSGGWEGAHCE
TNINDCSQNPCHNGGSCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTCYDEGD
AFKCMCPGGWEGTTCNIARNSSCLPSPCHNGGTCVVNGESFTCVCKEGWEGPICTQNTND
CSPHPCYNSGTCVDGENWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEINGYRCI
CPPGHSGAKCQEVSGRSCVTMGSVIPDGAKWDADCNACQCLDGRVACSKVWCGPRPCSLH
RGHSECPSGQSCVPILDTQCFVRPCTGVGECRSSSLQPVKTKCASDPYYQDNCANITFTF
NKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSPSANNEIHVAISAEDIRDDG
NPIKEITDKIINLVSKRDGNSSLIAAVAEVRVQRRPLKSRTDFLVPLLSSVLTVAWVCCL
VTAFYWCVRKRRKPGSHARAASEDNTTNNVREQLNQIKNPIEKHGANTVPVKDYESKNSK
MSKIRTHNSEVEEDDMDKHQQKARFAKQATYTLVDREEKPAHGTPAKHPNWTNKQDNRDL
ESAQSLNRMEYIV
Download sequence
Identical sequences L8J3Q3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]