SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L8J4C7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L8J4C7
Domain Number 1 Region: 12-262
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.66e-98
Family CAF1-like ribonuclease 0.000000000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) L8J4C7
Sequence length 285
Comment (tr|L8J4C7|L8J4C7_9CETA) CCR4-NOT transcription complex subunit 7 {ECO:0000313|EMBL:ELR62474.1} OX=72004 OS=Bos mutus (wild yak). GN=M91_03366 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADY
QYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSG
IQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELD
FFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFK
MREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEASKQS
Download sequence
Identical sequences B3DMA5 L8J4C7 Q3ZC01 Q543X5 Q60809 W5PI55
ENSMUSP00000034012 ENSMUSP00000117304 ENSMUSP00000122933 10090.ENSMUSP00000117304 10116.ENSRNOP00000016882 9913.ENSBTAP00000024009 ENSBTAP00000024009 ENSBTAP00000024009 ENSRNOP00000016882 ENSRNOP00000016882 ENSOARP00000010123 354698 GO.47604 NP_001029484.1.59421 NP_001029484.1.76553 NP_001100783.1.100692 NP_001100783.1.4139 NP_001258471.1.92730 NP_035265.1.92730 XP_004021782.1.66739 XP_004672650.1.11716 XP_005887455.1.15283 XP_005969114.1.78601 XP_006080217.1.26621 XP_010818548.1.76553 XP_010856676.1.44457 XP_011240485.1.92730 XP_012014570.1.54773 XP_017897409.1.57651 XP_019808973.1.53367 XP_020739027.1.74333 XP_020739035.1.74333 XP_020739043.1.74333 XP_021074272.1.100879 XP_021074273.1.100879 XP_021482848.1.76796 XP_021482849.1.76796 ENSMUSP00000034012 ENSMUSP00000034012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]