SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L9JHB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L9JHB1
Domain Number 1 Region: 1099-1274
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.82e-40
Family BCR-homology GTPase activation domain (BH-domain) 0.00076
Further Details:      
 
Domain Number 2 Region: 609-724
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 9.55e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.0015
Further Details:      
 
Domain Number 3 Region: 390-496
Classification Level Classification E-value
Superfamily PH domain-like 1.02e-23
Family Pleckstrin-homology domain (PH domain) 0.000013
Further Details:      
 
Domain Number 4 Region: 883-1014
Classification Level Classification E-value
Superfamily PH domain-like 1.1e-22
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 5 Region: 1385-1520
Classification Level Classification E-value
Superfamily PH domain-like 1.88e-18
Family Pleckstrin-homology domain (PH domain) 0.032
Further Details:      
 
Domain Number 6 Region: 9-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.16e-16
Family SAM (sterile alpha motif) domain 0.0000585
Further Details:      
 
Domain Number 7 Region: 510-608
Classification Level Classification E-value
Superfamily PH domain-like 5.03e-16
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 8 Region: 991-1091
Classification Level Classification E-value
Superfamily PH domain-like 0.000000118
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) L9JHB1
Sequence length 1705
Comment (tr|L9JHB1|L9JHB1_TUPCH) Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 {ECO:0000313|EMBL:ELW48442.1} KW=Complete proteome; Reference proteome OX=246437 OS=Tupaia chinensis (Chinese tree shrew). GN=TREES_T100016285 OC=Mammalia; Eutheria; Euarchontoglires; Scandentia; Tupaiidae; Tupaia.
Sequence
MSSVSEIDVDIKDFLMSINLEQYLSHFHECGFNSVKGCAAINDSVLQRIGISPTGHRRRI
LKQLQIILSKMQDIPIYANVHKTKKADDTSKDRHPPSSDQNVGIEPSDSSHVQTSAQLGT
DTKNLDPNDLSVEDSQSVKSHGGLSLFPHDFPILEEEPHPNLGSFQDSLFSSGNTKIDPL
IPKKTKDCTIEEQQTEKVDLTSENLGRLPDPDPECLSSLGCSTSEGNSGNGANGVLEIAP
PSPFFQFQGEMVVNDLYVPSSPNLAPMRSRSKLVSRPSRSFLLRHRPVPEIPGSTKGISG
SVYDNRKEKISEDKVEDIWIPREDKSSQLIDSASESEYSTVEECFQSLRRKNSKASKSRT
QKALTLDSVNRHSYLISCTSGNADASAVSSNAISPYACFYGASARKIKSGWLDKLSPQGK
RMFQKRWVKFDGLSISYYNNEKEMYSKGIIPLSAISTVRVQGDSKFEVVTTQRTFVFRVE
KEEERNDWISILLNALKSQSLTSQSPAVVTPEKCGYLELRGYKAKIYTVLSGNSVWLCKN
EQDFKSGLGITIIPMNVANVKQVDRTVKQSFEIITPYRSFSFTAESEKEKQDWIEAVQQS
IAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVICKKCAGQHRSLGPKDSKV
RSLKMDASIWSNELIELFIVIGNKRANDFWAGNLQKDEELHVDSPVEKRKNFITQKYKEG
KFRKTLLASLTKEELNKALCAAVVKPDVLETMALLFSGADVMCATGDPIHSTPYLLAKKA
GQSLQMEFLYHNKFSVKPDVLETMALLFSGADVMCATGDPIHSTPYLLAKKAGQSLQMEF
LYHNKFSDFPQHDVHSEGGLSQDSCQSTFLCDFLYQAPAAASKLSSEKKLLEETNKKWCV
LEGGFLSYYENDKSTTPNGTININEVICLAIHKEDFYLNTGPIFIFEIYLPSERVFLFGA
ETSQAQRKWTEAIAKHFVPFVAENLTEADYDLIGQLFYKDCHALDQWRKGWFAMDKSSLR
FCLQMQETQEDRMHLRRLQELTISTMVQNGEKLDVLLLVEKGRTLYIHGHTKLDFTVWHT
AIEKAAGTDGNALQDQQLSKNDVPIVVHSCIAFVTQYGLGCKYIYQKNGDPLHISELLES
FKKDARSFKLRAGKHQLEDVTGVLKRFLLDIDDALLTKQLYPYWISALDTQDDKERIKKY
GAFIRSLPGVNRATLAAIIEHLYRVQKCSEINHMDAHSLAMVFSSCLFQTKGQTNEEVNV
IEDLINNYVEIFEVSQAGDLLIEVYVERKEPDCSIIIRISPVMEADELTTDILAIKNIIP
AKGDIWATFEVIENEELERPLHYTENVLEQVLRWSSLAEPGSAYLVVKRFLTIDTIKHYR
EKSALESIKEGILKIKEEPSKILSGNKFQDRYFVLRDGHLFLYKDLKSSKHDKMIAVSSM
RFYLGVKKKTKPPTSWGLTAYSEKHHWHLCCDSLQTQMEWMASVFYAQHENDVWPPAGKE
RKRSITKNPKIGGLPLIPIQHERTATQARKNIEHENDVWPPAGKERKRSITKNPKIGGLP
LIPIQHERTATQARKNIESARAELERLRLSENHDKGSVDATLKERASIVAHCLEHKDDKL
RNRTRKHRSFNCLEDTESEVSHGQQKGQRGLKTLRKTEDRNSKVTLDSDHKLPSKVIEEL
NVVLQRSRTLQKELPDEQILQKELK
Download sequence
Identical sequences L9JHB1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]