SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L9V4N3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L9V4N3
Domain Number 1 Region: 445-526
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000000000000628
Family Carboxypeptidase regulatory domain 0.029
Further Details:      
 
Domain Number 2 Region: 530-591
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.0000000000263
Family Cna protein B-type domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) L9V4N3
Sequence length 596
Comment (tr|L9V4N3|L9V4N3_NATMM) Peptidase S8 and S53 subtilisin kexin sedolisin {ECO:0000313|EMBL:ELY32155.1} KW=Complete proteome OX=547559 OS=8861/ NBRC 102185 / NCIMB 2190 / MS3) (Natronobacterium magadii). GN=C500_04488 OC=Natrialba.
Sequence
HTITVETEDADASDTVTVLASNFELSNLDAPDEADRGDEITVSADVTNTGNVDDTQSVEY
RFDDLGDALDTQNVTLEPDENATVSFDVDTENVTEGTYDHGVFTEDDEATAAIDILEPFF
SVDLTDAPEELAPGDSYSVNATVENTGDASDEQTIAYELGDGGGDVAVVDVAADTSQGDA
VASVLDERLNNDTYDVDMVVADDLLDEMDDYDTFVVQRLGSDTLAEDFLDELESAQSAVY
LDSHQGGSAEAYADGIYRLNNVREDPEERDSEGIGTSSDPVTIDIEQNHPIFTGVGDAGD
EVEMFTGTTTWGSWFDDYSGTTLADADFGDGYAGPSVAVSDDGSELLLTATARDFFTDEE
DFTEEANQLLANSVEFTTTGSVTADAETADSSSVVHLEPGESEDLTFSDVVPEDTEAGDA
SHIVASEDEQDFAPVTITGDEANWNVKGTVSDDATDEPIENASVELEADNETYTNVTDAD
GEFGLADVPAGEHDLTVDAEGYASHTDAVHVPENDTATVDVSLEQAAGAISGDVMASDDD
APVENATIVAENDDGDVHEATTDENGSYELDGVSAGTYVVNVVDTPPGYELDEIVS
Download sequence
Identical sequences L9V4N3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]