SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M0BDX6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M0BDX6
Domain Number 1 Region: 5-31
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000506
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M0BDX6
Sequence length 42
Comment (tr|M0BDX6|M0BDX6_9EURY) Uncharacterized protein {ECO:0000313|EMBL:ELZ09091.1} KW=Complete proteome OX=1227489 OS=Haloterrigena thermotolerans DSM 11522. GN=C478_17309 OC=Haloterrigena.
Sequence
MEHPYGRCQHCGERLYAHIEGDYQCVNCDRRYTEADLETRAV
Download sequence
Identical sequences L0JMB6 M0BDX6
gi|433591386|ref|YP_007280882.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]