SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M0CPS2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M0CPS2
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily Vng1086c-like 1.02e-29
Family Vng1086c-like 0.0000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M0CPS2
Sequence length 92
Comment (tr|M0CPS2|M0CPS2_9EURY) Uncharacterized protein {ECO:0000313|EMBL:ELZ23874.1} KW=Complete proteome OX=1227488 OS=Haloterrigena salina JCM 13891. GN=C477_01710 OC=Haloterrigena.
Sequence
MHKDELLELHEELVVIMEYFAQREDVDEELFEPYRQLDVDPSHVHKSKSEHKHAVFVLGN
ALAKGMSEDEFSSAGRIGKRMKELAEDAESKI
Download sequence
Identical sequences D2RYQ1 M0CPS2
WP_008892689.1.92728 WP_008892689.1.95633 gi|284164346|ref|YP_003402625.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]