SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M0QWQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M0QWQ0
Domain Number 1 Region: 5-44
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 0.000000017
Family D-ribulose-5-phosphate 3-epimerase 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M0QWQ0
Sequence length 71
Comment (tr|M0QWQ0|M0QWQ0_MOUSE) Ribulose-phosphate 3-epimerase {ECO:0000313|Ensembl:ENSMUSP00000137941} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Rpe OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHPALQGGQFFCILFPISLL
VTLWLKASESS
Download sequence
Identical sequences M0QWQ0
ENSMUSP00000137941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]