SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M0QY62 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M0QY62
Domain Number 1 Region: 334-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.31e-23
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 2 Region: 530-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.1e-22
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 390-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.41e-22
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 4 Region: 475-531
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.45e-22
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 5 Region: 278-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.68e-21
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 6 Region: 10-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.22e-20
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 7 Region: 572-624
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.66e-19
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 8 Region: 223-279
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000884
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 9 Region: 437-468
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000563
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 89-148
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000538
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M0QY62
Sequence length 633
Comment (tr|M0QY62|M0QY62_HUMAN) Zinc finger protein 587B {ECO:0000313|Ensembl:ENSP00000469623} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ZNF587B OC=Catarrhini; Hominidae; Homo.
Sequence
MAVVATLRLSAQGTVTFEDVAVKFTQEEWNLLSEAQRCLYRDVTLENLALMSSLGCWCGV
EDEAAPSKQSIYIQRETQVRTPVTGVSPKKAHPCEMCGPILGDILHVADHQGTHHKQKLH
RCEAWGNKLYDSGNFHQHQNEHIGEKPYRGSVEEALFVKRCKLHVSGESSVFSESGKDFL
PRSGLLQQEASHTGEKSNSKTECVSPFQCGGAHYSHGDSMKHFSTKHILSQHQRLLPREE
CYVCCECGKSFSKYVSFSNHQRVHSGKRPYECGECEKSFSQKSSLIQHQQFHTGGKPYGC
EECGKYFSLEGYLRRHQKVHAGKGPYECGECGKSFSSNVNLKSHQRIHTGERPYKCGECE
KSFSRKPSLSYHQRIHTEVRPYKCGECGKSYISKGHLRIHQRMHTGERPYKCGDCGKSFN
EKGHLRSHQRVHTTERPYKCGECGKCFSHKGNLILHQHGHTRKRPYMCWECGKLFKKKSH
LLVHQRIHSGEKPYACEACQKFFRHKCHLTAHQRVHTGERPYECSDCGKSFTHSCAFIVH
KRVHTGQKPYECSECGKSFAASSYLTSHRRVHTGQKPYECSECGKSFAGISSLTNHRRVH
TGEKPYGCSECEKKFRKSSSLRYHQRVHERKAL
Download sequence
Identical sequences M0QY62
ENSP00000469623 ENSP00000469623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]