SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M0R412 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M0R412
Domain Number 1 Region: 37-212
Classification Level Classification E-value
Superfamily Lysozyme-like 1.44e-23
Family G-type lysozyme 0.00000864
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M0R412
Sequence length 212
Comment (tr|M0R412|M0R412_RAT) Lysozyme g-like protein {ECO:0000256|PIRNR:PIRNR001065} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Lyg2 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
TPRWVFWGLIALIGTARGSYPGFTHSTNPHVHSRLYHGCYGDVMTMETFGAPCDINNLMN
CGIHGSEMFAEMDLKAIKPYRILIKEVGQRHCIDPALIAAIISRESHGGAVLQNGWDHKG
QRFGLMQLDKNMYHPIGSWDSKEHLLQSVGILTERIKALKRKFPTWNAAQHLKGGLTAFK
SGMETIVTPADIEGDLVDDIIARAKFYKRHGF
Download sequence
Identical sequences M0R412
ENSRNOP00000064087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]