SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M0R9Q3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M0R9Q3
Domain Number 1 Region: 53-501
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.22e-109
Family L-arabinose binding protein-like 0.0039
Further Details:      
 
Weak hits

Sequence:  M0R9Q3
Domain Number - Region: 504-557
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00353
Family TNF receptor-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M0R9Q3
Sequence length 843
Comment (tr|M0R9Q3|M0R9Q3_RAT) Vomeronasal 2 receptor, 70 {ECO:0000313|Ensembl:ENSRNOP00000066230} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Vom2r70 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MKKLCAFTIAFLILKFSLILFHLTEPSCFWRIKNSEETDGDLRSDCGFVLFTFEEPIEEN
FYNQLINFRISARKYEFFLVMFFATDEINKNPYLLPNMSLIFSLGDRMCKDTLGVLDQIY
SQKNHSWHFINYVCGLERRCDIGLTGPSWTTSLKLAMDSRTPKVFFGPLNSNLRDHEQFP
YVHQIAIKDTRLPHGMVSLMLQFGWTWVGLIISDNDQGIQFLSDLREEMQRHGICLAFVN
MIPETMQIYMTKAKIYDQQLITSSAKVVIIYGEMNSTLEVSFRRWAYLGEQRIWVTNSQW
DVIINKTDFSLDFFHGTVTFAHHHSGMTIFRNVMQTISTSKYPVDISQSMLGWNHFNCSI
SDNRHSKMDHFTFNNTLEWLALHKFDMVLSEEGYNLYNAVYAVAHTYHELILQQVESQKV
SKHKGLFTDCQQVASLLKTRVFTNPVGELVNMNHRENQCAEYDIFIIWNFPQGLGLKVKI
ASYFPCFPHDQQLRISEDLEWATEGTLVSSSMCSVTCIAGFRKIHQKQTADCCFDCVQCP
ENEVSNETADMEQCARCPDDKYANSEQTYCLQRAVTYLAYEDSLGMALGCMALFFSVTTI
LVLVTFVKYKDTPIVKANNRILSYILLISLIFCFLCSLLFIGHPNKATCILQQITFGVFF
SVAVSAVLAKTVTVVMAFKLTTPGRRMRGMLALGAPNLVIPICTLIQLVLCGIWLVISPP
FIDRDIQSEHGKTIIICNKGSVIAFHFTLGYLGTLALMSFAVAFLARKLPDRFNEAKFLT
FSMLVFYSVWITFLPVYHSTRGKVMVVVEVFSILASSAGLLGCIFVPKCYVILVRPDLNF
LQK
Download sequence
Identical sequences M0R9Q3
NP_001092947.1.100692 NP_001092947.1.4139 10116.ENSRNOP00000044599 ENSRNOP00000044599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]