SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M0R9V7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M0R9V7
Domain Number 1 Region: 460-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.49e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 180-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.41e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 7-66
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.55e-23
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 4 Region: 236-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 516-573
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.71e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 292-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-21
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 404-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.91e-20
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 8 Region: 628-683
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.15e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 9 Region: 348-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.1e-18
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 129-181
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.91e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 11 Region: 562-614
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000205
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 12 Region: 82-129
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000105
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M0R9V7
Sequence length 691
Comment (tr|M0R9V7|M0R9V7_RAT) Zinc finger protein 728-like {ECO:0000313|Ensembl:ENSRNOP00000066288} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=LOC102551340 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
GVSSFFVFQEMLSFRDVAIDFSAEEWECLDLAQWKLYRDVMLENYNNLVFLGLASCKPYL
VTFLEQIQEPSDVKGRATTTMHPGGKCCTCKVCGRVFEWTKVFQNHQIIDLGVKGYECEE
CTKYTHIPSLLPEEKTIHTVEKPYKCEVCGKAFCIPLLLSKHKIIHTEENPYKCDLCGKA
FQHPSRLSRHKKIHSGDKPYKCEVCGKAFHFPSLLLVHKRIHTGEKPYKCEVCGKAFHYP
SILSKHKRIHTGEKPYKCEVCGKAFHISSFLSKHKIIHRGEKPYKCDVCGKAFHYPSRLS
NHKKIHSGEKPYKCEVCGKAFRILSLLSKHKIIHTEENPYKCEVCGKAFDYPSRLSTHSK
MHTEEKPYKCEACGKAFRSLSSLSKHRRIHTGDNYYNSEVCGKAFIYPLRLSKHKKICTG
EKPYKCEVCGKAFNDSLVLSKHRAIHTGEKLYKCDVCGKAFYYPSRLNNHRKIHSGEKPY
QCEECGKAFCFPSSLSKHKRIHTGEKPYKCKECDKAFRSLSSLSKHRRIHTGEKPYKCEV
CGKAFHYPSLLSKHKITHTEEKPYKCEVCGQGFHVPSKLSHHKIIHTGESPYKCEVCGKA
FCIPLLLSKHKISHTGENHSNSQLSKKAFIYPSRLSKHKKIHKRVKPYKCEVCGKAFRFP
SLLLIHKGIHTGEKPYKCDVCGKPSITHHYF
Download sequence
Identical sequences M0R9V7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]