SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M0RCC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M0RCC1
Domain Number 1 Region: 22-148
Classification Level Classification E-value
Superfamily Lysozyme-like 9.12e-48
Family C-type lysozyme 0.000025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M0RCC1
Sequence length 160
Comment (tr|M0RCC1|M0RCC1_RAT) Sperm acrosome-associated 5 {ECO:0000313|Ensembl:ENSRNOP00000067235} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=rCG_42923 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MQFCSTVVVILATLLLATVDAKIYERCELARKLEKAGLNGFKGYTVGDWLCVAHYESGFD
TSFVDHNPDGSSEYGIFQLNSAWWCNNGITPTQNLCHMDCNDLLNRHILDDIMCAKRVVS
SHKSMKAWDSWTRHCAGHDLSEWLKGCDVPLKADSNYDDW
Download sequence
Identical sequences M0RCC1
NP_001101528.1.100692 NP_001101528.1.4139 ENSRNOP00000067235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]