SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M0S7T0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M0S7T0
Domain Number 1 Region: 3-179
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.4e-39
Family PAPS reductase-like 0.0019
Further Details:      
 
Domain Number 2 Region: 253-360
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.36e-20
Family PDI-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M0S7T0
Sequence length 363
Comment (tr|M0S7T0|M0S7T0_MUSAM) Uncharacterized protein {ECO:0000313|EnsemblPlants:GSMUA_Achr2P13890_001} KW=Complete proteome; Reference proteome OX=214687 OS=Musa acuminata subsp. malaccensis (Wild banana) (Musa malaccensis). GN= OC=Musa.
Sequence
MDRALDMFGNEIAIAFSGAEDVALIEYAKLTGRPFRVFSLDTGRLNPETYRFFDAVEKHY
DIHIEYTFPDAGEVQALVRSKGLFSFYEDGHQECCRVRKVRPLRRMLKGLRAWVTGQRKD
QSPGTRANIPLVQVDPVFEGVDGLGSLIKWNPVADVEGKDIWNFLRTMNVPVNSLHSQGY
VSIGCEPCTRPVLPGQHEREGRWWWEDATAKECGLHKGNLKQDEAGKLGANGNGVAAANG
VDGTVDIFETQAIVNLSRPGIENLLKLEKRQEPWLVVLYAPWCRFCQGMETSYMELAEKL
VGSGIKVGKFRADGDQKPFAQKELQLGSFPTILFFPKNTSRPIKYPSEKRDVDSLLAFIN
ALR
Download sequence
Identical sequences M0S7T0
GSMUA_Achr2P13890_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]