SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M0WWL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M0WWL1
Domain Number 1 Region: 24-121
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.09e-28
Family Chaperone J-domain 0.00024
Further Details:      
 
Domain Number 2 Region: 199-309
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000683
Family Thioltransferase 0.077
Further Details:      
 
Domain Number 3 Region: 444-566
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000639
Family Calsequestrin 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M0WWL1
Sequence length 576
Comment (tr|M0WWL1|M0WWL1_HORVV) Uncharacterized protein {ECO:0000313|EnsemblPlants:HORVU4Hr1G056070.4} KW=Complete proteome; Reference proteome OX=112509 OS=Hordeum vulgare subsp. vulgare (Domesticated barley). GN= OC=Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum.
Sequence
MGIPIRSLLVASLVLSSIALHVAAKTLDPYKVLGVDKNASQRDIKKAFHKLSLKYHPDKN
KEKGAQQKFEEINNAHEILSDEEKRKNYDLYGDEKGNPGMGAGNFGSHDFTGGGPRTTYF
SSGDGWQTMGGQGNSKTFSFSFGGNPGADGGNPFGFNLGDVFSNMFAGGSMGGGQHGGFA
GSARPSARTSGQQKSPVTIQEVTMQTFNKEIADQGITWLLLFYTQQAKGQFVLESVLEDV
ARSLDGAVRAGKVNCDNEKTICKKSDVSVGKSARLFIYSYSTTEKGSLHEYSGDSDAKSL
KTFCQEHLPRFSRRVDITQFNFPSNALPNLPEVLLLSTKKDTPAMWRAVSGMFRNRLVFY
DAEVQDVSLPLLKRLGVKNVPALIGRTVNDEVQLLKDGISVKDLKSGIKELKTLLESFEK
KNKKLASEQAKKPAKASEPKENKIPLLTASNFEETCGEKAPVCIIGVFKSNKAKEKLERI
LSEISQKTLIRGQSYSSGNAITYALLDGNKQSAFLSAFDKSGYKSSDKLLLAYKPRRGRF
AVYKGEVSMEEAERFVASVLNGDVQFSATGQKPVLR
Download sequence
Identical sequences M0WWL1
MLOC_55253.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]