SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M0ZXL0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M0ZXL0
Domain Number 1 Region: 382-553
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.85e-53
Family Protein kinases, catalytic subunit 0.00036
Further Details:      
 
Domain Number 2 Region: 5-136
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.31e-22
Family alpha-D-mannose-specific plant lectins 0.0055
Further Details:      
 
Domain Number 3 Region: 94-207
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000955
Family alpha-D-mannose-specific plant lectins 0.0045
Further Details:      
 
Weak hits

Sequence:  M0ZXL0
Domain Number - Region: 211-242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00515
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M0ZXL0
Sequence length 598
Comment (tr|M0ZXL0|M0ZXL0_SOLTU) Uncharacterized protein {ECO:0000313|EnsemblPlants:PGSC0003DMT400010165} KW=Complete proteome; Reference proteome OX=4113 OS=Solanum tuberosum (Potato). GN= OC=Solaneae; Solanum.
Sequence
MPKKTAVWTANRNSPVVPSNAVLLLTNDGRLIVQVGGQEITVVNLSGQVIASASMLDTGN
FVLYNSDHSIIWQSFDNPTNTLLPGQHISAGQELFSSASVADDSYGIFRLKMQDDGNLVQ
YPVNTPDTAPYAYYSTRTSRVGNTVTLNLDDDGLLYLHNSTKRLRNLTRGGYPRERTIIY
MMKIDADGIFRVYSHSLNQQNSSVIWSSTNDGCNPIGLCGLNGFCTNIDDQAKCLCLPGF
DFVMPGNWSAGCERNFTAETCRLKESTSKYYAMRTVENTGWEDNRECRKQRLPLRYGRRE
LDNSNLVLVKVGTNFIPNKGVPNQTIEETKGKKLRIDILIASITLAVFALLVLGISGFLI
HRIHVWTYRKIQDSRSVQLCEDVAPRAFSYAELEQATSGFKEALGRGGFGTVFKGILAEG
QKVIAVKRLDKELVEGETEFQTEIKIIGRTHHRNLVRLLGYCLEGSRRLLVYEYMTNGSL
ADILFTPEKQPMWEERCGFARDIARGLLYLHDECDTQIIHCDIKPQNILMDDQYCAKISD
FGMAKLLKKDQNKNLHRDKRDQRLCCTRMAPKSASHCESRRLQFWCCPIGLDLQAEVC
Download sequence
Identical sequences M0ZXL0
PGSC0003DMP400007093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]