SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M1A7Y1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M1A7Y1
Domain Number - Region: 2-59
Classification Level Classification E-value
Superfamily WWE domain 0.0204
Family WWE domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M1A7Y1
Sequence length 60
Comment (tr|M1A7Y1|M1A7Y1_SOLTU) Uncharacterized protein {ECO:0000313|EnsemblPlants:PGSC0003DMT400016616} KW=Complete proteome; Reference proteome OX=4113 OS=Solanum tuberosum (Potato). GN= OC=Solaneae; Solanum.
Sequence
MYYQNSQWTDFLENIVSMAKQDLRIKKSATEVVFNDNNYVLDFFHMMLLDLKSGMQQPIV
Download sequence
Identical sequences M1A7Y1
PGSC0003DMP400011511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]