SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M1BCS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M1BCS5
Domain Number 1 Region: 94-203
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000013
Family Carboxylesterase 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M1BCS5
Sequence length 434
Comment (tr|M1BCS5|M1BCS5_SOLTU) Uncharacterized protein {ECO:0000313|EnsemblPlants:PGSC0003DMT400042261} KW=Complete proteome; Reference proteome OX=4113 OS=Solanum tuberosum (Potato). GN=102599594 OC=Solaneae; Solanum.
Sequence
MNCVTAPKANWLCSPAISFYSDSTKYYNRSSIRFYPGNRKFSRIRCNLKDTGSSSSNNQP
ETSTGIQLYRDIERLLTETVKQSQDWGSSQDWDEIEGAWVLQPKTSKPKLVVHFVGGVFV
GAAPQLSYRLFLERLRQKDVLVIATPYASGFDHFYIADEVQFKFDRCLRFLQERVQDLPV
FGIGHSLGSVIHLLIGARYAVKRNGNVLMAFNNKDASLAVPLFSSVLVPMMQNFGPVLSQ
IASSPTIRLGAEMTMKQIENLSPSIMKQVFPLVEQLTPLYTDLINGKENFTPRPEETQRL
IRSYYGISRNLLVKFKDDTIDETSTLAQVLSSGSAISSMLDMSIRTLPGDHALPLQQALP
NVPPGMTDAVNRSSELLANLTAGTPWENVTKEVGNTLGNVDSIILNSGNSKDLDMLVETI
TSWMYSNTGPRLLQ
Download sequence
Identical sequences M1BCS5
XP_006348531.1.80749 PGSC0003DMP400028662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]