SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M1GA94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M1GA94
Domain Number 1 Region: 541-586
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 2 Region: 119-150
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000236
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 56-104
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000641
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 4 Region: 496-533
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000089
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M1GA94
Sequence length 587
Comment (tr|M1GA94|M1GA94_OPLFA) Complement component 8 beta {ECO:0000313|EMBL:AFZ93889.1} OX=163134 OS=Oplegnathus fasciatus (Barred knifejaw) (Scaradon fasciatus). GN=C8 OC=Oplegnathus.
Sequence
MLSVVIRMSALSLQCCLLHVTLSLLLSEVAVTTASNEEPSVREARSVGDQVVVHPVDCVL
SEWTAWSRCDTCQKKRYRYAKLDQPSQFGGEPCNFHGREEEACIVSSRYTCDNVPLCEGF
LCTQTGRCIHRTLQCNGEDDCGDMSDEVGCKTASKPCRETVEEYWGIENLAKGINILNSN
LEGVVLDNRYYAGSCLPHYIQNVRFRKPYNLQQYTLQTKGSYDFTAQSFETYSDYMDHTA
KERATQTVVSIGFGIPGLFEFGFNFNNAKNTRSVKKIRRASSKTNSFVRAKAELELAQYM
LKSDDLMLHPEFLQRLRSLPQSYVYGEYRQIYRDYGTHYITEAGLGGQYEHTIILNKERL
ARTDYTLDDYKRCTQAGLKVGANIQGVYLSLGAHGGSCNGLLNEMGEDTERGSMVEDFVA
VVKGGSSESITALVSKKLPTPQLMGLWGEGVRFNPDFIRSTTRPLYELVTSRDFSQDATL
KRNLKRALSEYLAEASSCRCAPCHNNGVAVLKGTRCDCVCPVGYTGQGCEITQRRKDLAI
EGSWSCWGAWSSCSGRTMTRSRQCNNPAPSNGGLACRGLQQESSECF
Download sequence
Identical sequences M1GA94

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]