SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M1KDZ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M1KDZ3
Domain Number 1 Region: 50-147
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 1.7e-35
Family Chemosensory protein Csp2 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M1KDZ3
Sequence length 170
Comment (tr|M1KDZ3|M1KDZ3_APHGO) Chemosensory protein 1 {ECO:0000313|EMBL:AGE97641.1} OX=80765 OS=Aphis gossypii (Cotton aphid). GN=CSP1 OC=Aphidomorpha; Aphidoidea; Aphididae; Aphidini; Aphis; Aphis.
Sequence
MNILTIFCYVTVMCDTQVKPAVSAQRLQSVNQNVTPTNDGRKTIRETSSYPTRYDYIDIE
AVMNNERIIKILFNCVMSRGPCTREGLELKRIVPDAIQTECAKCNERQRKQAGKVLAHLL
QYKPEYWKMLVQKFDPNNVYLRKYMADNDDDEKLSLQKLSNDTTKKKRNI
Download sequence
Identical sequences M1KDZ3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]