SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M1UT04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M1UT04
Domain Number 1 Region: 192-280
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.58e-18
Family UAS domain 0.016
Further Details:      
 
Domain Number 2 Region: 372-490
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.91e-18
Family UBX domain 0.006
Further Details:      
 
Weak hits

Sequence:  M1UT04
Domain Number - Region: 6-46
Classification Level Classification E-value
Superfamily UBA-like 0.000221
Family TAP-C domain-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M1UT04
Sequence length 529
Comment (tr|M1UT04|M1UT04_CYAM1) Uncharacterized protein {ECO:0000313|EMBL:BAM80831.1} KW=Complete proteome; Reference proteome OX=280699 OS=Cyanidioschyzon merolae (strain 10D) (Red alga). GN=CYME_CML244C OC=Cyanidioschyzon.
Sequence
MAATEDSQNETLALFKNIAALDDNEVARAILSAHNWNIERAVDAFLTRGVEGALQPPNRT
GSLEFASTSDTSGTTPDASELSSAPVSGQLHASRLSESQPLTPALAETSTPERALQPALA
QATPSGVLGHLRRLLALPFQALRMVLAWCASLVTRIMGIDRYYRYAGRSRAVGAAAVAEL
EENLRTRYGMTIRYPTIYHGTFKEALEHSTQRCKLVLLYLHSEIHHATDRFVREILSDES
FIQFVNENFVFYAASVNRSPEAVELASYFTPAGYPYLAVVFASRRWPLGQLIDLRVLSDL
DRSMRGGRDAPITATDVLLWLQNVLLEYGDALRTAHTMRERRRSAQRLREEQDREFQEAL
AADQAAERARREFEQRAREEAAEQDQRRRERMAMLDRKRAALGPEPEPGEHVVTVLLRLP
DGKSTQRRFELSRSFRDLFDWAETSADIDFDRFELTTNFPKRAYSPASHSAMTLAEAGFK
QRVALLVTEIGWTRALPDASGKADVSDGNGNVEQKHLEQGNSSESKKQV
Download sequence
Identical sequences M1UT04
gnl|CMER|CML244C CML244CT XP_005536867.1.94140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]