SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M1ZX11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M1ZX11
Domain Number 1 Region: 1-173
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 2.09e-65
Family Clostridium neurotoxins, "coiled-coil" domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M1ZX11
Sequence length 173
Comment (tr|M1ZX11|M1ZX11_CLOBO) Botulinum neurotoxin type BivA4, nontoxic-nonhemagglutinin component, NTNH {ECO:0000313|EMBL:EKN41894.1} KW=Complete proteome OX=1232189 OS=Clostridium botulinum CFSAN001627. GN=CFSAN001627_10318 OC=Clostridium.
Sequence
SFDITATQEINTDCGINKVVTWFGKALNILNTSDSFVEEFQNLGPISLINKKENLSMPKI
EIDEIPNSMLNLSFKDLSENLFNIFSKNNSYFEKIYYDFLDQWWTQYYSQYFDLICMAKR
SVLAQESLIKKIIQKKLSYLIGNSNISSDNLALMNLTTTNTLRDISNESQIAM
Download sequence
Identical sequences M1ZX11

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]