SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M2PAE5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M2PAE5
Domain Number 1 Region: 411-515,552-568
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000744
Family UBX domain 0.035
Further Details:      
 
Domain Number 2 Region: 229-316
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000693
Family Glutathione peroxidase-like 0.07
Further Details:      
 
Weak hits

Sequence:  M2PAE5
Domain Number - Region: 8-50
Classification Level Classification E-value
Superfamily UBA-like 0.0163
Family UBA domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M2PAE5
Sequence length 619
Comment (tr|M2PAE5|M2PAE5_CERS8) Uncharacterized protein {ECO:0000313|EMBL:EMD32464.1} KW=Complete proteome; Reference proteome OX=914234 OS=subvermispora). GN=CERSUDRAFT_118799 OC=Agaricomycetes; Polyporales; Gelatoporiaceae; Gelatoporia.
Sequence
MDVESLTQSQRDALDQLQVVMNGGDPEVAIGVLSSVDWDVQRAAEIIFDQGAPAPPARTQ
PEPPVRESFELDDSEQGLLGGSHGREFNRVNSSSSSALVARPIRAIVGILTLPLRFLAAL
LRFLFRVLRIPMPQFTPFTSLTFSYRPLGPGSGRDTRYLDAKSAAERWVRSLEEETGAVC
VSHRRSRQPPETQTTSASGADVTAGSSGLTARSGTWEGETEADTDMKLLPDFYIGSYEDF
VRTCQRDMKIGCVILVSEEHDDVPEFKRSTLVDPAFVQLVTDNGILVWGGDIRDREPWSA
AQKLQATTYPFVAFIALQPRRTPGNNSSSTPTDTILSRHQGPSIPSTSGPTAAQTLVTHL
SEQLLPRVTPFLARLRTQAVEKERERASQTTARERERALRAEQDRAFEESKRRDAERIRR
VQEEERRAKEERAREEEAAQLAEEERGRRMLWRRWARRALIVREPRPGGEPDRGKTIRIG
VRMPDGRRVVRFFGEADQLVALYAYVDSLFVPPGTPTEGDPQAPPSGNAIGEEALVEEMQ
RSGKSPEKWWGFQLVLAYPRKEISWEAGRKIGEVDALKGGGQIVVEPMADESIGKGKQKA
QPATGDDGSDGYKTESDEE
Download sequence
Identical sequences M2PAE5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]