SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M2SQA5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M2SQA5
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.96e-44
Family GABARAP-like 0.0000284
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M2SQA5
Sequence length 119
Comment (tr|M2SQA5|M2SQA5_COCH5) Autophagy-related protein {ECO:0000256|RuleBase:RU004384} KW=Complete proteome; Reference proteome OX=701091 OS=(Southern corn leaf blight fungus) (Bipolaris maydis). GN=COCHEDRAFT_1184566 OC=Pleosporaceae; Bipolaris.
Sequence
MRSKFKDEHPFEKRKAEAERIRQKYNDRIPVICEKVEKSDIATIDKKKYLVPADLTVGQF
VYVIRKRIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGEAL
Download sequence
Identical sequences E3RX05 M2S9R5 M2SQA5 N4X184 W6YSU5 W6ZZ07 W7EVT3
jgi|CocheC5_1|25792|estExt_fgenesh1_kg.C_120034 jgi|Cocca1|32428|fgenesh1_pm.5_#_61 XP_003302160.1.2082 XP_007684559.1.18027 XP_007705035.1.66866 XP_007707196.1.9443 XP_014080593.1.79200 XP_014561898.1.39273 jgi|Cocmi1|85944|e_gw1.18.149.1 jgi|Cocvi1|85461|e_gw1.3.95.1 EFQ89746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]