SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M2TLT5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M2TLT5
Domain Number 1 Region: 1-73
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.3e-18
Family Ubiquitin-related 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M2TLT5
Sequence length 77
Comment (tr|M2TLT5|M2TLT5_COCSN) Uncharacterized protein {ECO:0000313|EMBL:EMD70121.1} KW=Complete proteome; Reference proteome OX=665912 OS=and spot blotch fungus) (Bipolaris sorokiniana). GN=COCSADRAFT_76343 OC=Pleosporaceae; Bipolaris.
Sequence
MILVTINDRLGTKTQVPCLPSDPIKLLKAMVAAKIGRPVHEIMLKRQGERPFHDNLTCAD
YAISNGVQIDLELNTGD
Download sequence
Identical sequences M2SM56 M2TLT5 N4X3U6 W6Y278 W6YS90 W7F015
jgi|Cocmi1|108708|e_gw1.243.9.1 jgi|Cocca1|95005|e_gw1.65.114.1 jgi|Coclu2|54964|fgenesh1_pm.17_#_340 jgi|Cocvi1|84908|e_gw1.2.500.1 XP_007692996.1.18027 XP_007695253.1.66866 XP_007711854.1.9443 XP_014080259.1.79200 XP_014562130.1.39273 jgi|CocheC5_1|109589|estExt_Genewise1Plus.C_150409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]