SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M2UCF1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M2UCF1
Domain Number 1 Region: 118-238
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.55e-21
Family Ubiquitin-related 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M2UCF1
Sequence length 257
Comment (tr|M2UCF1|M2UCF1_COCH5) Uncharacterized protein {ECO:0000313|EMBL:EMD91346.1} KW=Complete proteome; Reference proteome OX=701091 OS=(Southern corn leaf blight fungus) (Bipolaris maydis). GN=COCHEDRAFT_1021405 OC=Pleosporaceae; Bipolaris.
Sequence
MSSPADQASTAPQSTPHQQTSGSRPQSRNEPPSTGSVEMKTLEASGAAPAPTDTTTHTTD
APAVAPAATPAEQPVGSSTSEDAPVAPSSPGKLAPPSALNRADTEAIGPSTDTPAANPDN
TNGPVLVIMLLLTSGARHPYKIDEKYLKKRSVKVENMDPYNISVYTLKELIWRDWREEWE
ARPTSPGSIRLIHFGRMLDDKSPLKECRFQTDTPNVVHMTVKPQEVVDEEENAKTGKSGN
RRESDDEPTATCRCVIL
Download sequence
Identical sequences M2UCF1 N4XRD3
jgi|CocheC5_1|29297|estExt_fgenesh1_pg.C_60334 XP_014082805.1.79200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]