SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M2UH05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M2UH05
Domain Number 1 Region: 178-312
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.17e-19
Family UBX domain 0.0045
Further Details:      
 
Domain Number 2 Region: 5-41
Classification Level Classification E-value
Superfamily UBA-like 0.0000000334
Family UBA domain 0.0062
Further Details:      
 
Weak hits

Sequence:  M2UH05
Domain Number - Region: 70-104
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00392
Family Classic zinc finger, C2H2 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M2UH05
Sequence length 313
Comment (tr|M2UH05|M2UH05_COCH5) Uncharacterized protein {ECO:0000313|EMBL:EMD97734.1} KW=Complete proteome; Reference proteome OX=701091 OS=(Southern corn leaf blight fungus) (Bipolaris maydis). GN=COCHEDRAFT_1019070 OC=Pleosporaceae; Bipolaris.
Sequence
MASSDLDTLVDMGFDRERAELAVKVSGGLQSAIDWLETNQDKSIDEIKQAQASSAAGASD
EPPALQPGEEAKSLVCDECGKKFRSVNQAQFHGEKTGHEQFSESTEEIAPLTEEEKKQRL
QELREKLAAKRAKMSEQDKEDQRRNEQIRMKATKESQDIREELQKKERLKEAAAKRAEKK
ADEEARKRVLAKLEADKQERKRKAEEEKAKRAGQALPAPAAQAPLATSSGPSTSKPASAY
TEARLALQTPSGRVMKTFPVETTLFEVAHALEQDGLSVNTFTTNFPKKTYDKTDFGMTLK
EAGMVPSAALIVG
Download sequence
Identical sequences M2UH05 N4WTU1
jgi|CocheC5_1|25860|estExt_fgenesh1_kg.C_130037 XP_014076779.1.79200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]