SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3UZS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3UZS9
Domain Number 1 Region: 81-217
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 7.22e-23
Family PWWP domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3UZS9
Sequence length 335
Comment (tr|M3UZS9|M3UZS9_ENTHI) PWWP domain containing protein {ECO:0000313|EMBL:EMH77472.1} KW=Complete proteome OX=885319 OS=Entamoeba histolytica HM-1:IMSS-B. GN=EHI8A_161280 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MEEEKQVDTTTVQSSTPPMSPQHSHSITPSASPKENKVSTPLSPNKEDGSVATPTSRKKE
EETKPKKSPNDSVTVIDKEIEQNKWDNWTVVWVKQKGYPWWPAKIIIMDKLNEKTKGQLE
KLIEFKKDKKYLVKYITNGYQFGWVNDNQIKPFKEEFMNIITERMLGKKDVIESINKAIE
ITNDKISENDIDKFHKAVIKKEKQMEEEEKKKEKMRNCDIGFMVVNDPLIEITKIEGIVE
KSIENNNSSLQKLKNWKEMDHSQVIEELNTLMKEPIMIHEIINPINKIGELLNSICQSTN
IEISVLAERVLERIKKELKYAIISGEYQRCKEIFN
Download sequence
Identical sequences A0A175JJJ0 C4LYJ2 M3UZS9 M7W3R8 N9TPU7
jCVI|EHI_094010 gi|56474527|gb|EAL51892.1| gi|67484098|ref|XP_657269.1| 294381.C4LYJ2 XP_657269.1.49425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]