SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3W2Q2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3W2Q2
Domain Number 1 Region: 1125-1301
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.2e-40
Family BCR-homology GTPase activation domain (BH-domain) 0.0006
Further Details:      
 
Domain Number 2 Region: 687-802
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.96e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.0014
Further Details:      
 
Domain Number 3 Region: 453-574
Classification Level Classification E-value
Superfamily PH domain-like 9.82e-26
Family Pleckstrin-homology domain (PH domain) 0.0000126
Further Details:      
 
Domain Number 4 Region: 914-1040
Classification Level Classification E-value
Superfamily PH domain-like 2.83e-21
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 5 Region: 1435-1570
Classification Level Classification E-value
Superfamily PH domain-like 3.34e-19
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 
Domain Number 6 Region: 5-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.72e-16
Family SAM (sterile alpha motif) domain 0.0000474
Further Details:      
 
Domain Number 7 Region: 585-702
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000277
Family Pleckstrin-homology domain (PH domain) 0.031
Further Details:      
 
Domain Number 8 Region: 1018-1112
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000563
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3W2Q2
Sequence length 1681
Comment (tr|M3W2Q2|M3W2Q2_FELCA) ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2 {ECO:0000313|Ensembl:ENSFCAP00000004368} KW=Complete proteome; Reference proteome OX=9685 OS=Felis catus (Cat) (Felis silvestris catus). GN=ARAP2 OC=Felinae; Felis.
Sequence
MSSVSEVNVDIRDFLMSINLEQYLLRFREFGFDTVKDCAAVNDSVLHKIGISPTGHRRRI
LKQLQIILSKMQDIPIYANVHKTKKDDETSKVPHVPFSDGSNSVDLSDAGGIQAPSPTQW
ETVTKTLDQNDVSVENSQSLKSDDKLSLPKHNFPLPEEEPHPSLNSFQHTLFGSENIKGE
SLITEITMDCAIEEQQTNRADLISENVSQLPDVDSECLSSLRPSVSEANSGSGTNGLLER
SLPSPFFQFQGEMVVNDLYVPSSPILAPMRSRSKLVSRPSRSFLLRHRPVPEIPGSTKGI
SGSYFRERRNIATSTGKSVTQENSKEENSSSIFPYGETFLFQRLENSKKRSIKNEFWTHE
ETLKGETTTEKNSFLVKSSIYDNRKENISEDKAEDIWIPREDKVNFPVDSASESEYSTVE
ECFQSLRRKNSKASKSRTQKALNLDPVNRHSYPLSSTSGNAESSIVSSNAISPYACFYGS
SARKVKSGWLDKLSPQGKRMFQKRWVKFDGLSISYYNNEKEKYSKGIIPLSAISTVRVQG
DNKFEVVTTQRTFVFRVEKEEERNDWISILLNALKSQSPALQSQAAAAPEKCGYLELRGY
KAKIFTVLSGNSVWLCKNEQDFRSGLGITIIPMNVANVKQVVRTVKQSFEIITPYRSFSF
TAESEKEKQEWIEAVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVI
CKKCAGQHRSLGPKDSKVRSLKMDASIWSNELIELFIVIGNKRANDFWAGNLQKDEELHM
DSPVEKRKTFITQKYKEGRFRKTLLASLTKEELNKALCAAVVKPDVLETMALLFSGADVM
CATGDPVHSTPYLLAKKAGQSLQMEFLYHNKFSDFPQHDIHSEGGLGQEPSQSMFLCDFL
YQASAAASKLSTEKKLLEETNKKWCVLEGGFLSYYENDKSTTPNGTINISEVICLSVHKE
DFYLNTGPIFTFEIYLPSERAFLFGAETSQAQRKWTEAIAKHFVPFVAENLTEADYDLIG
QLYYKDCHTLDQWRKGWFSMDKSSLRFCLPMQEVQEYRMHLRRLQELTISTVVQNGEKID
VLLLVEKGRTLYIHGHSKLDFTVWHTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIAFV
TQYGLGCKYIYQKNGDPLHISELLESFKKDARSFKLRAGKHQLEDVTGVLKNFLSDIDDA
LLTKELYPYWISALDTQDDKERIKKYGAFIRSLPGVNRATLAAVIEHLYRVQKCSEINHM
NAHNLALVFSSCLFQTKGQTSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKD
TQVSQAGDLLIEVYVEKKEPDCSIIIRISPVMEAEELTNDILAIKNIIPVKGDIWATFEV
IENEELERPLHYTENVLEQVLRWSSLAEPGSAYLVVKRFLTIDTVNHYNERRALESIKEG
VLKIKEEPSKILSGNKFQDRYFVLRDGYLFLYKDSKSSKYEKMFSLSSMKFYLGVKKKMK
PPTSWGLTAYSEKHHWHICCDNLQTQTEWMASVFIAQHENDILPPAGKERKRSITKNPKI
GGLPLIPIQHERSATQARKNIESARAELERLRLSEKRDQELGDGSLRERASMVAQCLEHK
DEKLRTRTRKHRSFNCLEDTETEVLHGQQKSQKALKTWRKPEDSNGKAVLDSDKTAGQFM
K
Download sequence
Identical sequences M3W2Q2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]