SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3W4J0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3W4J0
Domain Number 1 Region: 18-196
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.86e-73
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000112
Further Details:      
 
Domain Number 2 Region: 191-323
Classification Level Classification E-value
Superfamily E set domains 4.67e-51
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.000000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3W4J0
Sequence length 555
Comment (tr|M3W4J0|M3W4J0_FELCA) RELA proto-oncogene, NF-kB subunit {ECO:0000313|Ensembl:ENSFCAP00000005287} KW=Complete proteome; Reference proteome OX=9685 OS=Felis catus (Cat) (Felis silvestris catus). GN=RELA OC=Felinae; Felis.
Sequence
LSDLFPLIFPTEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLPPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSSAAVPKPAPQPYPFTPSLSTINF
EEFSPMVFPSGQIPSQTPALAPAPAPILAPAPASVPAPAPVPAPAPAPAPAPAPILAPGL
AQAVVPPAPKTTQAGEGTLTEALLHLQFDADEDLGALLGNSADPAVFTDLASVDNSEFQQ
LLNQGVSVAPHPAEPMLMEYPEAITRLVTGSQRPPDPAPAPLGASGLPNGLLSGDEDFSS
IADMDFSALLSQISS
Download sequence
Identical sequences M3W4J0
ENSFCAP00000005287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]