SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3WA55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3WA55
Domain Number 1 Region: 698-757
Classification Level Classification E-value
Superfamily R3H domain 0.00000000000182
Family R3H domain 0.0028
Further Details:      
 
Domain Number 2 Region: 431-510
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00000000038
Family Double-stranded RNA-binding domain (dsRBD) 0.0074
Further Details:      
 
Domain Number 3 Region: 534-611
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00000000447
Family Double-stranded RNA-binding domain (dsRBD) 0.01
Further Details:      
 
Weak hits

Sequence:  M3WA55
Domain Number - Region: 263-284
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00445
Family Formin homology 2 domain (FH2 domain) 0.051
Further Details:      
 
Domain Number - Region: 285-370
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00678
Family Double-stranded RNA-binding domain (dsRBD) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3WA55
Sequence length 784
Comment (tr|M3WA55|M3WA55_FELCA) NFKB repressing factor {ECO:0000313|Ensembl:ENSFCAP00000008104} KW=Complete proteome; Reference proteome OX=9685 OS=Felis catus (Cat) (Felis silvestris catus). GN=NKRF OC=Felinae; Felis.
Sequence
MAGGRLLLGGDFLSPPPLPPLPPPPLPPLPPPPPEPVLEQWRYSHESDWQWALRRSFICR
HLHSYPGAALDQLLALSAAWTNHVFLGCRYSPRLMEKILQMAEGIDIGEMPSYDLMLSKP
SKGQKRHLSTCDGQNPPKKQAGSKFHARPRFEPVHFVASSSKDERQEDPYGPQTKEVNEQ
THFASMPRDIYQDYTQDSFSIQDGNSQYCDSSGFIFTKDQPVTANMYFDSGNPAPSSTSQ
QANSQSAPEPSPSQTFPESVVAEKQYFIEKLTATIWKNLSNPEMTSGSDKINYTYMLTRC
IQACKTNPEYIYAPLKEIPPADIPKNKKLLTDGYACEVRCQNIYLTTGYAGSKNGSRDRA
TELAVKLLQKRIEVRVVRRKFKHTIGEDLVVCQIGMPSYEFPPALKPPEELVVLAKDASG
QPIFNASAKHWTNFVLTENANDAIGILNNSASYNKMSVEYKYEMMPNRTWRCRVFLQDHC
LAEGYGTKKTSKHAAADEALKILQKTQPTYPSVKSSQCQTGSSPRGSGKKKDIKDLVVYE
NSSNPVCTLNDTAQFNRMTVEYVYERMTGLRWKCKVILESEVIAEAVGVKKTVKYEAAGE
AVKTLKKTQPTVINNLKKGAIEDVISRNEIQGRSAEEAYKQQIKEDNIGNQLLRKMGWTG
GGLGKSGEGIREPISVKEQHKREGLGLDVERVNKIAKRDIEQIIRNYARSESHTDLTFST
ELTNDERKQIHQIAQKYGLKSKSHGVGHDRYLVVGRKRRKEDLLDQLKQEGQVGHYELVM
PQAN
Download sequence
Identical sequences M3WA55
ENSFCAP00000008104 XP_004000877.2.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]