SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3WH42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3WH42
Domain Number 1 Region: 74-121
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000706
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 2 Region: 35-76
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000314
Family Somatomedin B domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3WH42
Sequence length 253
Comment (tr|M3WH42|M3WH42_FELCA) Somatomedin B and thrombospondin type 1 domain containing {ECO:0000313|Ensembl:ENSFCAP00000011623} KW=Complete proteome; Reference proteome OX=9685 OS=Felis catus (Cat) (Felis silvestris catus). GN=SBSPON OC=Felinae; Felis.
Sequence
MRTLWMALCALARLWPGTLAGCAEAGRCCPGRDAACFVRGWRLDRVYGTCFCDQACRLTG
DCCFDYARACPARPCIVGEWSPWSRCGDQCKPAARVRRRPVRQEPRNGGAPCPPLEERAG
CLDYSTPRGQDCGHSFVPAFITTSAFNKERTRQSTSPQWSTDTEDSGYCMEFKTESLTHH
CALENRPLTRWMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRC
QGTWKKVRSTQVP
Download sequence
Identical sequences M3WH42
XP_006943326.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]