SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3WLL5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3WLL5
Domain Number 1 Region: 33-146
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-28
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 2 Region: 241-355
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000327
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 444-481
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000484
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 154-191
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 200-239
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000118
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 405-442
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3WLL5
Sequence length 759
Comment (tr|M3WLL5|M3WLL5_FELCA) LDL receptor related protein 3 {ECO:0000313|Ensembl:ENSFCAP00000013840} KW=Complete proteome; Reference proteome OX=9685 OS=Felis catus (Cat) (Felis silvestris catus). GN=LRP3 OC=Felinae; Felis.
Sequence
MRSQQSGEIVKPNYVNIVLTGRLSSAVPALAACSGKLEQHTERRGVIYSPAWPLNYPPGT
NCSWYIQGDRGDMITISFRNFDVEESHQCSLDWLMLGPAAPPRQEAFRLCGSAIPPAFIS
ARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQASCQADEFRCDNGKCLPGPWQCNTVDE
CGDGSDEGNCSAPASEPPGSLCPGGTFPCSGARSTRCLPAERRCDGTQDCGDGSDEAGCP
DLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDPRRVLLQLELRLGYDDYVQV
YEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFNATYQVKGYCLP
WEQPCGSSSEGAAGDAGEQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQYPCEGGSGLC
YAPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCIFETWRCDGQEDCQDGSDEHGCL
AAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRLEAEFVRREAP
PSYGQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPSRRRLGRLWNR
LFHRPRAPRGQIPLLTAARTSQTVLGDGLLQPAPGTTPDPPAPLTDTGSPVVAGDGPPSV
PGHASEAGSAVPPPSGLRDPECRLGDKDRKACRDSLVDSLAPAEAPREPCSAQDPHPLAP
TASSTLGPHPPEPLGVCRSPPPPCSPTLEASDDEALLVC
Download sequence
Identical sequences M3WLL5
XP_019675164.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]