SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3WNI4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3WNI4
Domain Number 1 Region: 35-148
Classification Level Classification E-value
Superfamily PH domain-like 2e-38
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000417
Further Details:      
 
Domain Number 2 Region: 241-370
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.29e-29
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000129
Further Details:      
 
Domain Number 3 Region: 428-489
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000209
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3WNI4
Sequence length 501
Comment (tr|M3WNI4|M3WNI4_FELCA) Wiskott-Aldrich syndrome {ECO:0000313|Ensembl:ENSFCAP00000015382} KW=Complete proteome; Reference proteome OX=9685 OS=Felis catus (Cat) (Felis silvestris catus). GN=WAS OC=Felinae; Felis.
Sequence
MSGGPVGGRSGGRGGPGVQQNVPSTLLQDHENQRLFEMLGRKCWTLATAVVQLYLALPPG
AEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGQLLWEQELYSQLVYSTPTPYFHTFAGD
DCQAGLNFADEGEAQAFRALVQEKIQKRNQRQSGDRRQLPPPPAPANEERRGPPPLPPHP
GGDQGGPAAGPLSLGLVTVDIQNPDITSSRYRGLPAPGPGPADKKRSGKKKISKADIGAP
SGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGLE
AVRQEMRRQEPLPPPPPPSRGGNQPPRPPTIGSNKGRSGPLPPVPLGGAPPPPTPRGPPP
PGRGGPPPPPPPATGRSGPPPPPPSGPGGTPVPPPPPPPPPPPPSSDDGPVPPPPPALGP
VGGLAPSGGRGALLDQIRQGIQLNKTPGAPESSALQPPPPRSEGLVGALMHVMQKRSRAI
HSSDEGEDQAGDEDEDDEWDD
Download sequence
Identical sequences M3WNI4
XP_004000534.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]