SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3WX49 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3WX49
Domain Number 1 Region: 428-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.67e-24
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 
Domain Number 2 Region: 316-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.12e-24
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 3 Region: 484-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-23
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 10-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.68e-22
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 5 Region: 372-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.98e-21
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 6 Region: 259-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.87e-20
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 7 Region: 529-581
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-18
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 8 Region: 125-175
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000617
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3WX49
Sequence length 633
Comment (tr|M3WX49|M3WX49_FELCA) Zinc finger protein 792 {ECO:0000313|Ensembl:ENSFCAP00000018938} KW=Complete proteome; Reference proteome OX=9685 OS=Felis catus (Cat) (Felis silvestris catus). GN=ZNF792 OC=Felinae; Felis.
Sequence
MAAAAALRDPAQGCVTFEDVTIYFSQEEWGLLDEAQRLLYCDVMLENFALIASLGLTSFR
SHIVARLEMGAEPWVPDRVDMTSAMARGAYSGPGSDFCSGTEGEHSASVGVPRDRNLKAA
LSGQKDYSCNMCGLRLKDILALAEHRAAHPRQKPYVCQAYGREFKSSAYHNQHQMQQGVD
KPIRRDEDRASLMKSCRDDASKKPFTVREGGKDFADGKAGSGFLPPQVPHRVEEPPRDTG
VGDRHTVQSHNKCSESGNTFSDKRALVQHQRTHAGERPYECNKCGIFFSHASGLLQHQRD
HNRGKPYECRECGKFFSQHSSLVKHQRVHTGESPHVCSECGKFFSRNSNLIQHKRVHTGE
KPYECSECGKFFSQRSNLIHHKRVHTGRSAHECSECGKSFNCNSSLIKHWRVHTGERPYK
CNECGKFFSHIASLIQHQIVHTGERPYGCSECGKAFSRSSDLMKHQRVHTGERPYECVEC
GKLFSQSSSLNSHRRLHTGERPYQCPECGKFFNQSSSLNNHRRLHTGERPYECLECGKTF
RQRSNLRQHQKVHKPDRPYKCSECGKAFSQRPTLVRHQKIHIRERSAENVLPPPAQPCAL
DISSEGRLYEGAISERLNLVHPNVHTGKIPYEY
Download sequence
Identical sequences M3WX49
XP_003998036.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]