SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3X9G8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3X9G8
Domain Number 1 Region: 96-472
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 5.75e-101
Family Formin homology 2 domain (FH2 domain) 0.0000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3X9G8
Sequence length 1130
Comment (tr|M3X9G8|M3X9G8_FELCA) FH2 domain containing 1 {ECO:0000313|Ensembl:ENSFCAP00000023270} KW=Complete proteome; Reference proteome OX=9685 OS=Felis catus (Cat) (Felis silvestris catus). GN=FHDC1 OC=Felinae; Felis.
Sequence
MHVMNCVSLVSDKENGNVASAAGFMIGQTPPPPPPPPPPPPPCPYSGEGFLPSPPPPPPP
PLPGMPPVPPPPPGLPPASHMNGYSHLGKKKRMRNFFWKTIPEEQVRGKTNIWTLAARQQ
HHYQIDTKTIEELFGQQEDTTKPSLSRRGGTLNSSFRDPKEEITILDAKRSMNIGIFLKQ
FKKSPQSIVEDIHQGKSEHYGSETLREFLKLLPESEEIKKLKTFSGDVSKLSLADSFLHY
LIQVPNYSLRIEAMVLKKEFLPSCSSLYTDITILRTATKELMLCEELHSILHLVLQAGNI
MNAGGYAGNAVGFKLSSLLKLADTKANKPGMNLLHFVAQEAQKKDAILLNFSEKLHHVQE
AARLSLDNTEAELRSLFIRTRSLRENIQRDGELCQQVEDFLQFAVEKLTELERWKQELQD
EAHTLIDFFCEDKETMKLDECLQIFRDFCVKFNKAVKDNQDRAVQELRQLQRLKEREQKR
RSWAAGELGGFCRSSSENDVELLTKKGTEDLPPFLQPRPVSPSYRPPNARRSRLSLGAFA
DRELLTFLESSTGSPEEPSKFNSLPRSSPRQARPTLAWMEPGGPRAQDPSHARRPQASQS
QEEAPEPPSSWQSQLPVPRPEDPAPLFPRARRSGVGILQKRNSEPMGLAPARSPPLSPLA
LGIKEHELVTGLAQFDLQGPKGPEEVPRLTLNDFSSVEPVSLGDGSMQSLAASHSGLLPV
SSSAPGGLSPALQGNDGSVPDQPSGEALVSVGSSDPESKDPSPLFYISDATDCSLTLDCS
EPGEGGGGDGSLSSGAGETGSQVSSHPPSSPPGEASAPLSGKSEPSCKDALPRDRPAKGK
DATTPKRSSLREASQGTSKAVSARRSQGAAPKPVRTLTASESESMRKVVPISRSSRSSVG
WKRPPGDTPSSPAQQQWSRRSSVRGTSDVSPRRPSTGAVTVPEEPKLARGSSSSGSVRPG
KEHPLQPRGSFKKPSAKPLRNVPRQKPEENKICRSNSESPEEEPKAPPPPSVPRVPPPVP
SFARNTVASSSRSMRTDSPPVAKAPGITRTVSQRQPRPKGSPEDAIPKDSGTLRRASSAR
APKKCPESAGGPSANTETPPKGRGAGERASLRLKNSDPTTLGKILDPLRK
Download sequence
Identical sequences M3X9G8
ENSFCAP00000023270 XP_003984982.1.62641 XP_019684396.1.62641 XP_019684397.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]