SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XAM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XAM3
Domain Number 1 Region: 623-723
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000533
Family Spectrin repeat 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3XAM3
Sequence length 768
Comment (tr|M3XAM3|M3XAM3_FELCA) Centrosomal protein 68 {ECO:0000313|Ensembl:ENSFCAP00000023677} KW=Complete proteome; Reference proteome OX=9685 OS=Felis catus (Cat) (Felis silvestris catus). GN=CEP68 OC=Felinae; Felis.
Sequence
MALGEEKAEVEAPADTKALSYGQWSCREREVDTPGLTSGEQEQPPHLEAEGGLASPVWGT
EGLPAPACCDRAGPSPSGAYQPQANNTRREPVAGRSKPALGCLLPSAGPGTGDLLHSVES
QMEETRLSASEELPQTLTVPRATGLCSGHDADTEDDPSPVESPRALDLSRQPHSSGFPFP
TRWRSVVSQGTAVPQFSSRSVSASSPGGSLQGHQEKAEPQSCSIAKVSSSLELATPHSAP
SVGSGPRLQWSPQPASSGVDAPGLGRRRLSFQAEYWACVLPDSLPPSPDRHSPLWNPNKE
YEDLLDYTYPLRPKPHLPKHLDSHVLADPVLQDSGVDLDSFSVSPASTLKSPTNGSQNCP
SAEASALPFSRPGDPGLRRWSSGIPQKQGSVGLASCNQLTSTPRAPGGRDAPWESREPAP
RGVKDWLGYMGKHPEAGSPQRRTWERGWPLPRTEREKGASQGVWHPACTESGWKPEEEVE
SDDEYLALPARLTQVSSLVSHLGSIPTLVTLPTGAAEGQTSLDVSDSDGPASLPSDSSQS
QLPSEAALRGSRGPEGQNHRLLCSFIHARGSAGEGGLGNSQALGVSSGPLRAHSSLPAVW
DRHAFLDLDAAGQPPGKGEPGKESLVQCVKTFCCQLEELIRWLYNIADVTDHLIPSKSNL
TGLKSSLQLYRQFKKDIDEHQSLTESVLQKGEILLQCLLDNTPVLKDVLGRISKQPSELE
SHADRLYDAILASLDMLAGCTLIPDNTPVAHRSTDVKGISLASSKAEM
Download sequence
Identical sequences M3XAM3
ENSFCAP00000023677 XP_006930204.1.62641 XP_019682850.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]