SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XHH0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XHH0
Domain Number 1 Region: 332-607
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-76
Family Protein kinases, catalytic subunit 0.00000000164
Further Details:      
 
Domain Number 2 Region: 209-336
Classification Level Classification E-value
Superfamily SH2 domain 2.56e-33
Family SH2 domain 0.000039
Further Details:      
 
Domain Number 3 Region: 6-128
Classification Level Classification E-value
Superfamily PH domain-like 2.68e-31
Family Pleckstrin-homology domain (PH domain) 0.00000139
Further Details:      
 
Domain Number 4 Region: 146-230
Classification Level Classification E-value
Superfamily SH3-domain 7.22e-18
Family SH3-domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3XHH0
Sequence length 615
Comment (tr|M3XHH0|M3XHH0_LATCH) Tyrosine-protein kinase {ECO:0000256|RuleBase:RU362096} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=BTK OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
MNMTLNEGKKGSKKGSVDVDKISCVETVAPEENPPPERQILRKGDDMVEMEQISVIERFP
YPFQIIYDEGPLYIFAPTEELRQRWIKELKNVTRFNKDLAQKYHPCFWIDGEWLCCKQIA
KTAIGCQILEIRNGSLKAGRAHRKSRKPLPPTPQEEQKIKPLPLVPEHSSPAKTKVIVAL
YDYKPMEALDMPLVKGEEYYVIEEANAQWWKARDKNGQEGYIPSNYVTEATDQLQIFEWY
SKHITRSQAEQRLREEGKDGGFIVRDSSRPGKYTVSVFTKATGEPNGMIRHYVVCSTPQN
QYYLAEKYHFASIPDLIKYHQHNSAGLISRLKHPVSTWSSSAPSTAGLGYGIWEIDPKDL
TFLNELGNGQFGVVKHGKWRGQHDVAIKMIKEGSMSEDDFIDEAKVMMNLSHAKLVQLYG
ICTKERPIFIVTEFMANGCLLNYLRENNKRPHTTELLEMCKDVCEAMEYLESQQFLHRDL
AARNCLVDTRGIVKVSDFGLSRYVMDDEYTSSIGSKFPVRWSPPEVLLYNKFSSKSDVWS
FGVLMWEIYTLGKMPYERFNNSETADNVTKGLRLYRPQLATDRIYPIMYSCWHERPEERP
SFRVLLSNILDLLEE
Download sequence
Identical sequences M3XHH0
ENSLACP00000022176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]