SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XK08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XK08
Domain Number 1 Region: 110-242
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 0.0000000000000549
Family AlkB-like 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3XK08
Sequence length 243
Comment (tr|M3XK08|M3XK08_LATCH) Uncharacterized protein {ECO:0000313|Ensembl:ENSLACP00000023064} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=LOC102351158 OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
MAASGYTDLREKLKSMTPYREPNYSKSSNNSTNKTSDYGAGESRKRKYQDSEEEYSDYEE
HLRREEAAQKVKSGIRQIKLFSSEECVKIEAKIEEVVSRAEKGLYREHTVDRAPLRNKYF
FGEGYTYGSQLQKRGPGQERLYPRGDVDEIPDWVRELVIQKLVDQRVIPEGFVNSAVIND
YQPGGCIVSHVDPIHIFERPIVSVSFFSDSALCFGCKFQFKPIRVSEPVFFLPVKRGSVT
VLR
Download sequence
Identical sequences M3XK08
ENSLACP00000023064 ENSLACP00000023064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]