SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XLA7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XLA7
Domain Number 1 Region: 23-188
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 7.06e-40
Family CRAL/TRIO domain 0.0022
Further Details:      
 
Domain Number 2 Region: 251-389
Classification Level Classification E-value
Superfamily PapD-like 1.54e-36
Family MSP-like 0.0000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3XLA7
Sequence length 459
Comment (tr|M3XLA7|M3XLA7_LATCH) Uncharacterized protein {ECO:0000313|Ensembl:ENSLACP00000023513} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=MOSPD2 OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
MIDESFQWRKEFGVNDLSESVLPRWTFETGAVFLHGYDKEGNKLFWFKVKLHIKDAKTAL
EKKKYVAFWLERYAKREPGKYLTVVFDMMETGLSNIDMDFVRFVINCFKIYYPKYLSKMV
IFEMPWIMNAAWKIVRSWLGPEAVSKLKFASRSEIQEYISVEYLPPHMGGIDPFKYSYPP
LPDDDFQTPMCENGPIVSEDETEMKDDAELESKDTVDSNHNEEQMLKSKKVTFTEEVQCK
QEEHGKMKSIKKPVTVFKGPLVHISPAEELHFGSKESGERKCLIILNNVTKNPVAFKVRT
TAPEKYRVKPSNSSCEAGASLDIVVSLHGGSEASPQDRFLVMAAEIDQPVGAGTPDLAQF
WKELPRNKVMEHRLRCHVVESNKPAIASFSDSTLGSIPSKDSKEHLHLKLTKLLASNARL
EEQINQCIWFQQLLGVLVSLLVAITCSCLYLLLTNDDSK
Download sequence
Identical sequences M3XLA7
XP_006009772.1.90931 ENSLACP00000023513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]