SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XLR2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XLR2
Domain Number 1 Region: 36-79
Classification Level Classification E-value
Superfamily TNF receptor-like 1.65e-16
Family BAFF receptor-like 0.00045
Further Details:      
 
Domain Number 2 Region: 4-39
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000141
Family BAFF receptor-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3XLR2
Sequence length 262
Comment (tr|M3XLR2|M3XLR2_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000000012} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MAMELCPEEQYWDSLLNICFSCKPICSHQFPRTCAAFCKSLSCRKEEGRYYDQLLKDCIS
CASVCGRHPKQCTYFCENKFRSHVNLPPELKRQRSGEAETRSDDLGRYQGTEHRGSEAGP
GLKLSADQLALVYSTLGLCLCAIVCCFLLAVACFLKRRGDQFSCQPSAAPCRTQAKSSKD
HWMEAGSAAGTPPEPVETCSFCFPERRQPTQESAGASRTPDAAPSGRWARLGPSATAQPC
ARAPDGGLEVLCAPAEEGGPAA
Download sequence
Identical sequences M3XLR2
ENSMPUP00000000012 XP_012903343.1.14098 XP_012903344.1.14098 ENSMPUP00000000012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]