SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XLZ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XLZ0
Domain Number 1 Region: 188-391
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.58e-51
Family DBL homology domain (DH-domain) 0.000000301
Further Details:      
 
Domain Number 2 Region: 2-225
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.11e-39
Family Calponin-homology domain, CH-domain 0.0056
Further Details:      
 
Domain Number 3 Region: 378-540
Classification Level Classification E-value
Superfamily PH domain-like 1.63e-32
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 
Domain Number 4 Region: 667-768,817-843
Classification Level Classification E-value
Superfamily SH2 domain 2.99e-27
Family SH2 domain 0.00051
Further Details:      
 
Domain Number 5 Region: 587-697
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000177
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 6 Region: 784-832
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000235
Family SH3-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3XLZ0
Sequence length 847
Comment (tr|M3XLZ0|M3XLZ0_MUSPF) Vav guanine nucleotide exchange factor 3 {ECO:0000313|Ensembl:ENSMPUP00000000090} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=VAV3 OC=Mustelinae; Mustela.
Sequence
MEPWKQCAQWLIHCKVLPANHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLRAHSINLKEI
NLRPQMSQFLCLKNIRTFLTACCETFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTPI
ALATGIRPFPTEESISDEDIYKGLPDLIDETHVEDEEGLYDCVYGEDEGGEVYEDLMKAE
EAHQPKCPENDVRSCCLAEIKQTEEKYTETLESIEKYFMAPLKRFLTAAEFDSVFINIPE
LVKVHRNLMQEIHDSIVNKNDQNLYQVFINYKERLVIYGQYCSGVELAISSLDNISKTKE
DVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTTDPTEKANLKLALDA
MKDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLLFGRPQGDGEIRITTLDKHTKQER
HIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKENKKWSYGFYLIHTQGQNGL
EFYCKTKDLKKKWLEQFEMALSNIRPDYADSNFHEFKMHTFNRVTSCKVCQMLLRGTFYQ
GYLCFKCGARAHKECLGRVDNCGRVNSAEPGTLKPPEKRTNGLRRSPRQVDPGLPKMQVI
KNYTGVPLPAHHEGPPLHIQAGDTVELLRGDAHSLFWQGRNLASGEVGFFPSDAVKPCPC
VPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIK
ILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEHSAGQRGNRA
GNSLLSPKVLGIAIARYDFCARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPS
TYVEEDE
Download sequence
Identical sequences M3XLZ0
XP_004777564.1.14098 ENSMPUP00000000090 ENSMPUP00000000090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]