SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XM79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XM79
Domain Number 1 Region: 393-551
Classification Level Classification E-value
Superfamily Lipocalins 1.4e-46
Family Rv2717c-like 0.0000763
Further Details:      
 
Domain Number 2 Region: 1-63
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000214
Family THAP domain 0.00094
Further Details:      
 
Weak hits

Sequence:  M3XM79
Domain Number - Region: 272-366
Classification Level Classification E-value
Superfamily Mediator hinge subcomplex-like 0.0706
Family MED7 hinge region 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3XM79
Sequence length 553
Comment (tr|M3XM79|M3XM79_MUSPF) THAP domain containing 4 {ECO:0000313|Ensembl:ENSMPUP00000000179} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=THAP4 OC=Mustelinae; Mustela.
Sequence
FPLKDSKRLIQWLKAVQRDNWTPTKYSFLCSEHFTKDSFSKRLEDQHRLLKPTAVPSIFH
LPEKKRGTGGHGRTRRKVTRKSSGGLRGHASGADGKGATGSSSSLGENPMAKPGSRKAKQ
VALQGETAPRASQDAASQERTRQAPEGAPGDGLASAAAAAGSQGEADTSAVEASGESTAT
ASDGGLVDKSGISVDDFTPPGSGACKFIGSLHSYSFSSKHTRERASVPREPVDRKRLKRD
VEPGCSGSSLGPDKGLAQSPPSSSLTATPQKPSQGPSAPPTDVTPKPAAEAVQSEHSDAS
PMSINEVILSASGACKLIDSLHSYCFSSRQNKSQVCCLREQVEKKNGELKSLRQRVSRSD
SQVRKLQEKLDELRRVSFPYLSSLLPFSREPPTMNPVVEPLSWMLGTWLSDPPGAGTFPT
LQPFQYLEEVYISHVGQPVLNFSFNAFHPDTRKPMHRECGFIRLKPDTNKVAFVSAQNTG
IVEVEEGEVNGQELCITSHSIARISFAKEPHVEQITRKFRLNSEGKLEQTVSMATTTQPM
TQHLHITYKKVTP
Download sequence
Identical sequences M3XM79
ENSMPUP00000000179 ENSMPUP00000000179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]