SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XMC7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XMC7
Domain Number 1 Region: 235-479
Classification Level Classification E-value
Superfamily Caspase-like 2.24e-56
Family Caspase catalytic domain 0.00023
Further Details:      
 
Domain Number 2 Region: 90-191
Classification Level Classification E-value
Superfamily DEATH domain 5.06e-23
Family DEATH effector domain, DED 0.0064
Further Details:      
 
Domain Number 3 Region: 5-74
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000165
Family DEATH effector domain, DED 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3XMC7
Sequence length 482
Comment (tr|M3XMC7|M3XMC7_MUSPF) CASP8 and FADD like apoptosis regulator {ECO:0000313|Ensembl:ENSMPUP00000000227} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=CFLAR OC=Mustelinae; Mustela.
Sequence
MSTEVIHQVEEALDEDEKKVLLFLCRDVAADVAPLNVRDLLDILSERGVLSAMGLAELLY
RVRRFDLLKRIFKMDRRAVEAHLLRHPGLISDYRVLMTEIGGNLENSDLSSLFFLMRDYL
GRRKVAKDKSFLDLVIELEKLNLIAPDQLDLLEKCLKNIHRVDLKTKIQKYKQSAQGPET
SYTNALQASFRNLSLKDPSCNLRLQNGRTKEQRLNVGQLDLQRESVKASIQESEAFLPRH
VPEERYRMQSKPLGICLIIDCIGNDAAFLRDTFTSLGYEVQSFLYLSVDGIIQVLRRVAC
MPQHRDYDSFVCVLVSRGGSHSVFGVDRTHSGFPLDQIRRMFMGDACPFLLGKPKVFFIQ
NYVDSEDPLDNSSLLEVDGPAVNNLESKAKQPGSSTLHREADFLWSLCKADVSLLERSSS
SPSLYLQCLSQKLGKERRRPLLELHIELNGSVYDWNSRASTKERYSVWLQHTLRKKLILS
WE
Download sequence
Identical sequences M3XMC7
ENSMPUP00000000227 XP_004764213.1.14098 XP_004764215.1.14098 XP_004764217.1.14098 XP_004764218.1.14098 XP_004764219.1.14098 XP_012917726.1.14098 XP_012917727.1.14098 ENSMPUP00000000227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]