SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XMF2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XMF2
Domain Number 1 Region: 428-630
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.53e-59
Family Nucleotide and nucleoside kinases 0.0001
Further Details:      
 
Domain Number 2 Region: 219-324
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-28
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 129-233
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-20
Family PDZ domain 0.0018
Further Details:      
 
Domain Number 4 Region: 86-136
Classification Level Classification E-value
Superfamily L27 domain 0.0000000000000165
Family L27 domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3XMF2
Sequence length 639
Comment (tr|M3XMF2|M3XMF2_MUSPF) Membrane palmitoylated protein 4 {ECO:0000313|Ensembl:ENSMPUP00000000252} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=MPP4 OC=Mustelinae; Mustela.
Sequence
RTQSDRGAHPLDKKNMKPSTATNPENGVSQILRLVLRELNLFYSRDVNGVCLLYDLLHSP
WLQALLKVYNCLLEFKEKKLVPATTHAQTLSCEVVGLLRETPKSPEIQELKQILQDPHFK
ALLSAHDSVAQKDFEPLLPPLPDNIPESEEAMRIVCIVKNQQPLGATIKRHEMTGDILVA
RVIHGGLAERSGLLYAGDKLVEVNGVPVEGLDPEQVIHILAMSRGTIMFKVVPVSAPPVN
SQKTVYVRAMTEYWPQEDPAIPCMDAGLPFQKGDILQIVDQNDALWWQARKISDLGTCAG
LIPSNHLLKRKQREFWWSQPYQPPSGLKPTISISMEDDDMKIDEKCVEAGETIDEETFES
EELSEDKEEFVGSGQKFFIAGFRRSMRLCRRKSHLGQLRAGLGGGGGGLPAPGAPYEEVV
RYQRRPSEQHRLVVLVGPSGVGVNELRRQLIELNPEQFQSAVPHTTRSKKSYEVDGREYH
YVSKEVFESLVYSHRMLEHGEYKGHLYGTSVDAVQTVLDEGKICVMDLEPQGIQLARTQE
LKPYVIFIKPSSMSRMKQSRKNAKIITDYFVDMKFKDEDLQEMEDLAQKMEAQFGQFFDH
VIVNDNLQDACAQLVSAIQKAQEEPQWVPATWISSDTES
Download sequence
Identical sequences M3XMF2
ENSMPUP00000000252 ENSMPUP00000000252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]