SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XMF9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XMF9
Domain Number 1 Region: 20-91
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000214
Family PARP-type zinc finger 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3XMF9
Sequence length 105
Comment (tr|M3XMF9|M3XMF9_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000000259} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MLHLPCFLARSQVEFCSGSFEIAKRGMASCKKRSRGDMREWYHIKCTFEKLKWAQATTKD
IEDHIELESWEELEDNEKAQIIQHIADLSSKKCPNSLFSEIKYSG
Download sequence
Identical sequences M3XMF9
ENSMPUP00000000259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]