SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XMX9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XMX9
Domain Number 1 Region: 288-398
Classification Level Classification E-value
Superfamily PDZ domain-like 3.94e-27
Family PDZ domain 0.0026
Further Details:      
 
Domain Number 2 Region: 408-521
Classification Level Classification E-value
Superfamily PDZ domain-like 7.36e-26
Family PDZ domain 0.00000484
Further Details:      
 
Domain Number 3 Region: 111-219
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-17
Family PDZ domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3XMX9
Sequence length 1129
Comment (tr|M3XMX9|M3XMX9_MUSPF) Par-3 family cell polarity regulator beta {ECO:0000313|Ensembl:ENSMPUP00000000429} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=PARD3B OC=Mustelinae; Mustela.
Sequence
MLIAVFDEQEPLHKIESPSGNPAGRQSPDAFETEVAAQLAAFKPIGREIEVTPSALKLGT
PLLVRRSSDPAPGPPADAQPRASHPSGQSLKPVILDSTQNLEDEEVMNGVQTEPLTSLKT
KAALSDMTRTVEISGEGGPLGIHVVPFFSSLSGRILGLFIRGIEENSRSKREGLFHENEC
IVKINSVDLVDKTFAQAQDVFRQAMKSPSVLLHVLPPQNREQYEKSVIGSLNIFGNNDGV
LRTKPQPPVHGIAGIKTVTLTGTGGPEEDALTSLQQSKSPRVPRLGRKPSSPSLSPLMGF
GSKKNAKKIKIDLKKGPEGLGFTVVTRDSSIHGPGPIFVKNILPKGAAIKDGRLQSGDRI
LEVNGRDVTGRTQEELVAMLRSTKQGETASLVIARQEGTFLPRELKGEPDCYALSLETTE
QLTFEIPLNDSGSAGLGVSLKGNKSRETGTDLGIFIKSIIHGGAAFKDGRLRMNDQLIAV
NGESLLGKSNHEAMETLRRSMSMEGNIRGMIQLVILRRPERPLEEPAECGAFSKPCFENC
QNTITTSRRNDNSSLHPFGTYSSQDKQKVLLLPSDGWADPEVPPSPPPHPVLELGLEDYS
HSSGVDSVAYFPDQHIHFRSVTPARQPESMNLKASKSMDLVSDESKVHSLAAHKSDSPSK
DFGPTLGLKKSSSLESLQTAVAEVRKNELPFHRPRPHMVRGRGCNESFRAAIDKSYDGPE
ELEADGLSDKSSHSGQGALSCESVPQGSPELEDGEQKARKIKKPKEKEKKKEKGKLKAKE
KKLKEENEDPERKIKKKGFGAMLRFGKKKDDRGGKTEQKGSLKHGALTGEEREKMKERER
IVAKHQELREKQARGLLDSAAGATGSLHDMDDDEMDPNYARVNHFREPCASSVYRSPSPP
RAGPLGYHRESRPLSPERDHLEGLYAKVNKPYHPLVPAESGRPASGSTDRIQKLRKEYYQ
ARREGFTLYEDDEGRARLDYDLHWVSGKGPDGNAHNVRFEGMERQYASLPRGGPADPVDY
LTATPRALYQERELPYYPGVHPVRPPKGSYPRPPDLRVADLRYPQYYPPPPAPQHKGPFR
QDVPPSPPQQHRVPANPEMGRPGPRGGSPDQYPYRAQDPRQKSPMTAAV
Download sequence
Identical sequences M3XMX9
ENSMPUP00000000429 ENSMPUP00000000429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]