SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XN88 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XN88
Domain Number 1 Region: 19-303
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.51e-65
Family Ankyrin repeat 0.0000231
Further Details:      
 
Domain Number 2 Region: 334-428
Classification Level Classification E-value
Superfamily DEATH domain 2.75e-16
Family DEATH domain, DD 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3XN88
Sequence length 443
Comment (tr|M3XN88|M3XN88_MUSPF) Ankyrin repeat and death domain containing 1A {ECO:0000313|Ensembl:ENSMPUP00000000538} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=ANKDD1A OC=Mustelinae; Mustela.
Sequence
MEEPLAWETDGLLPMERQLHEAARRNNIGRMKELMERRVNIRARNHVGRVALHWAAGAGH
EPAVRLLLEHKAAVDDEDAFGMNALLLSAWFGHLQILQILVNSGAKIHCENKDGLTLLHC
AAQKGHMPVLAFIMEDLEDVPLDHADKLGRTAFHRAAEHGQLDALDFLVGSGCDHSVKDK
KKQSCLHYAVLGGSEDMARTLIHAGGHTNMADHQGVSPLHLAVKHNFPALVQLLLDAGSD
LDAIDNRQQTPLHLAAEHARQDIAEMLLIAGVNLNLRDKQGKTALAVAARSNHVSLVDMI
IKADRLYTWEKDHPLRKDPKDPYRKNLTFKQDHLQERQQFHSVLWRLASRDLRPHEWKKL
AYCWEFTEAHVHAIEQQWTGSKSYQEHGHRMLLIWLHGVATAGENPGKALFEGLVAIGRR
NLAESIRKKANADLGTPSRCTAM
Download sequence
Identical sequences M3XN88
ENSMPUP00000000538 ENSMPUP00000000538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]