SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XNE6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XNE6
Domain Number 1 Region: 2-111
Classification Level Classification E-value
Superfamily PX domain 3.27e-28
Family PX domain 0.0011
Further Details:      
 
Domain Number 2 Region: 151-362
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000000107
Family IMD domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3XNE6
Sequence length 364
Comment (tr|M3XNE6|M3XNE6_MUSPF) Sorting nexin 1 {ECO:0000313|Ensembl:ENSMPUP00000000596} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=SNX1 OC=Mustelinae; Mustela.
Sequence
MNAYVAYKVTTQTSLPMFRSKQFAVKRRFSDFLGLYEKLSEKHSQNGFIVPPPPEKSLIG
MTKVKVGKEDSSSAEFLEKRRAALERYLQRIVNHPTMLQDPDVREFLEKEELPRAVGTQT
LSGAGLLKMFNKATDAVSKMTIKMNESDIWFEEKLQEVECEEQRLRKLHAVVETLVNHRK
ELALNTAQFAKSLAMLGSSEDNTALSRALSQLAEVEEKIEQLHQEQANNDFFLLAELLSD
YIRLLAIVRAAFDQRMKTWQRWQDAQATLQKKREAEARLLWANKPDKLQQAKDEILEWES
RVTQYERDFERISTVVRKEVIRFEKEKSKDFKNHVIKYLETLLSSQQQLAKYWEAFLPEA
KAIS
Download sequence
Identical sequences M3XNE6
ENSMPUP00000000596 ENSMPUP00000000596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]