SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XNH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XNH5
Domain Number 1 Region: 236-320
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-23
Family PDZ domain 0.0016
Further Details:      
 
Domain Number 2 Region: 2-94
Classification Level Classification E-value
Superfamily PDZ domain-like 1.04e-21
Family PDZ domain 0.0011
Further Details:      
 
Domain Number 3 Region: 127-217
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-21
Family PDZ domain 0.001
Further Details:      
 
Domain Number 4 Region: 354-459
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-21
Family PDZ domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3XNH5
Sequence length 521
Comment (tr|M3XNH5|M3XNH5_MUSPF) PDZ domain containing 1 {ECO:0000313|Ensembl:ENSMPUP00000000625} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=PDZK1 OC=Mustelinae; Mustela.
Sequence
MASTFHPRECELSKQEGQSYGFFLRIEKDTDGHLVRVVEKGSPAEKAGLQDGDRVLRING
VFVDKEEHMQVVDLVRKSGNSVTLLVLDGNSYEKAMKKQVDLKELSQSRKEPSLNDKKLP
SVVNQGAQTWTQPRLCYLVKEGNSYGFSLKTVQGKKGVYMTDITPQGVAMKAGVLAGDHL
IEVNGENVEDASHEEVVAKVKNSGSRVMFLLVDKETDKLHAEQKIKFKRETASLKLLPHQ
PRVVEMKKGSNGYGFYLRAGPEQKGQVIKDIDSGSPAEEAGLKNNDLLVAVNGQSVESLD
HDSVVEMIRKGGDQTSLLVVDKETDNMYRLAHFSPFLYYQSQELPNGSIKEAPAPMPDPT
PPEVSSPDTTEEARDHKPKLCWLVKGENGCGFHLNAIQGQPGSFIKEVQKGGPAELAGLE
DEDIIIEVNGVNVVDEPYEKVVESIQSSGKNVTFLVCGKKAYEYFQAKKIPIVSSMADPL
DAPTDSKEETPAEPEHDSHMAKERAYSTASHSSSNSEDTEM
Download sequence
Identical sequences M3XNH5
ENSMPUP00000000625 ENSMPUP00000000625 XP_004779688.1.14098 XP_004779689.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]