SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XNQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XNQ0
Domain Number 1 Region: 479-536
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-26
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 2 Region: 367-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.55e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 311-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.62e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 423-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 80-141
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.23e-24
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 6 Region: 535-592
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.67e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 7 Region: 581-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.96e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 8 Region: 273-325
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.13e-18
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3XNQ0
Sequence length 638
Comment (tr|M3XNQ0|M3XNQ0_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000000700} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MEFVRKSAAVQPRHQFPSLVRRRSCARRPGGGGEKCPQAKYPACLRCGAPVGVRVAAGPG
AFSRRGSREGEMATGLLPAQAQESVTFRDVAVFFSQDEWLRLDSAQRTLYREVMLENYGT
LVSLGILFSKPKVIFQLQQGEDPWMVENGVSQGPCVGWERLFETTVSEEENQEVMNKLLG
DGPFNFKLGKAYINEDKLKKQQGKKNKPFRKVLITIKNTYMRERSFASIELGKNLSLKSP
LIRKPRLVSRGRKPHSQQYSVLFKQLGVNTVRRCYKCNICGKIFLHSSSLSKHQRIHTGE
KLYKCKECRKAFSQSSSLTQHLRVHTGEKPYICGECGKAFSFTTSLIGHQRMHTGERPYK
CNECGKTFKGSSSLNNHQRIHTGEKPYKCNECGRAFSQCSSLIQHHRIHTGEKPYECSQC
GKAFTSISRLSRHHRIHTGEKPFNCNECGKVFSYHSALIIHQRIHTGEKPYACKECGKAF
SQSSALIQHQRIHTGEKPYKCNECGKAFSWISRLNIHNRIHTGEKPYNCKECGKAFSSHS
AVNTHRKIHTGEKPYKCNDCEKAFNQSSALIQHQRIHTGEKPFNCKVCGKAFRQSSSLMT
HMRIHTGEKPYKCKECGKAFSQSSSLTNHQRTHTGEKL
Download sequence
Identical sequences M3XNQ0
ENSMPUP00000000700 ENSMPUP00000000700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]